E4.1 precursor (N02995) Nucleic Acid Card

General Information
Name E4.1 precursor
Organism Conus ermineus (Atlantic fish-hunting cone)
Organism Diet piscivorous
Organism Clade III
Organism Region Western Atlantic and Caribbean,Eastern Atlantic and Mediterranean
Notes

Sequence
atgctgtgtcttccggtcttcatcatccttcttctgttgg
tttcatctgcagctccaaaccctttggaaacgagaatcca
aagcgattcgattcgtgcagcccttgaagatgccgatata
aaaaccgataaacggcttattggcggcttaatcggcggcc
ttgccgccttactcggccttctttttccgaagtga
Sequence translation MLCLPVFIILLLLVSSAAPNPLETRIQSDSIRAALEDADI
KTDKRLIGGLIGGLAALLGLLFPK-

References
Abalde, S., Tenorio, M.J., Afonso, C.M. and Zardoya, R. (2018) Conotoxin diversity in Chelyconus ermineus (Born, 1778) and the convergent origin of piscivory in the Atlantic and Indo-Pacific cones Genome biology and evolution 10:2643-2662

Internal links
Proteins Encoded E4.1 precursor

External links
Ncbi
GenBank MH360499

Tools