reg12l precursor (N03009) Nucleic Acid Card

General Information
Name reg12l precursor
Organism Conus regius
Organism Diet vermivorous
Organism Clade XVII
Organism Region Eastern Pacific
Notes

Sequence
CGCGTGCTGTTTCGCAGCGGCGATCAGCCGGCGGATCAGC
CGGCGGAACGCATGCAGGATATTAGCCCGGAACAGAACCC
GCTGTTTCATCCGGATAAACGCCGCTGCTGCCCGATGCCG
GGCTGCTTTGCGGGCCCGTTTTGCCCGTGCTGCCCGCCG
Sequence translation RVLFRSGDQPADQPAERMQDISPEQNPLFHPDKRRCCPMP
GCFAGPFCPCCPP

References
Franco,A., Dovell,S., Möller,C., Grandal,M., Clark,E. and Marí,F. (2018) Structural plasticity of mini-M conotoxins - expression of all mini-M subtypes by Conus regius. FEBS J. 285:887-902

Internal links
Proteins Encoded reg12l precursor

External links
Ncbi
GenBank MF588938

Tools