reg3.8 precursor (N03013) Nucleic Acid Card

General Information
Name reg3.8 precursor
Organism Conus regius
Organism Diet vermivorous
Organism Clade XVII
Organism Region Eastern Pacific
Notes

Sequence
ATGATGAGCAAACTGGGCGTGCTGCTGACCATTTGCCTGC
TGCTGTTTCCGCTGAGCGTGCTGCCGCTGGATGGCGATCA
GCTGGCGGATCAGCCGGCGCGCCATGCGCAGAGCGCGGAA
CGCAACGCGCGCTTTCATCCGGTGAAACGCTGCTGCCCGT
TTCCGATGTGCTATCAGGTGCCGCATTGCCCGTGCTGCGG
C
Sequence translation MMSKLGVLLTICLLLFPLSVLPLDGDQLADQPARHAQSAE
RNARFHPVKRCCPFPMCYQVPHCPCCG

References
Franco,A., Dovell,S., Möller,C., Grandal,M., Clark,E. and Marí,F. (2018) Structural plasticity of mini-M conotoxins - expression of all mini-M subtypes by Conus regius. FEBS J. 285:887-902

Internal links
Proteins Encoded reg3.8 precursor

External links
Ncbi
GenBank MF588942

Tools