conophysin-conopressin-M1 precursor (N03054) Nucleic Acid Card

General Information
Name conophysin-conopressin-M1 precursor
Organism Conus monile
Organism Diet vermivorous
Organism Clade
Organism Region Indo-Pacific
Notes

Sequence
C
ATGCAGATGGGACGACCGACGTTGCTGCCGTGTTTGCTG
CTACTGCTAGTGCTCTCTACCCAGGCTTGCTTTATCAGAA
ACTGCCCAGAGGGTGGCAAGAGAGATGTGCACATGATACA
ACCTACCAAGCCGTGCATGAACTGTAGCTTTGGCCAGTGT
GTGGGGCCCCGTGTCTGCTGTGGAGCTGGACGATGCGAAA
TAGGATCGACAGAAGCGGACAGGTGCGAAGAAGAGAACGA
GGATCCTGTTCCTTGCAAGGTCCTTGGTCAGCACTGTGTT
CTGAACAACCCAGGCAACGTCAACGGCAACTGTGTTGATG
GTGGCATCGGCATCTGCTGTGTGGATGATACTTGTGCCAT
CCACCGGAGATGTGAT
T
Sequence translation MQMGRPTLLPCLLLLLVLSTQACFIRNCPEGGKRDVHMIQ
PTKPCMNCSFGQCVGPRVCCGAGRCEIGSTEADRCEEENE
DPVPCKVLGQHCVLNNPGNVNGNCVDGGIGICCVDDTCAI
HRRCD

References
Kumar,S., Vijayasarathy,M., Venkatesha,M.A., Sunita,P. and Balaram,P. (2020) Cone Snail Analogs of the Pituitary Hormones Oxytocin/Vasopressin and Their Carrier Protein Neurophysin. Proteomic and Transcriptomic Identification of Conopressins and Conophysins Biochim Biophys Acta Proteins Proteom 1868:140391

Internal links
Proteins Encoded conophysin-conopressin-M1 precursor

External links
Ncbi
GenBank KY982973.1

Tools