conophysin-conopressin Mi precursor (N03055) Nucleic Acid Card

General Information
Name conophysin-conopressin Mi precursor
Organism Conus miles
Organism Diet vermivorous
Organism Clade XII
Organism Region Indo-Pacific
Notes

Sequence
ATGAAGTGTTCCGTTCTGCAGATGAGCCGCCTGTCCTGGG
CCATGTGTCTGATGCTGCTGATGGTGCTGCTCCTGGGAAC
TGCCCACGGCTGCTTCATCAGGAACTGCCCGCGGGGCGGC
AAGAGAGCGGTGGACGCCGTGCAGCCTACCAGACAGTGTA
TGCCGTGCGGCCCTGACGGCATGGGCCAGTGCGTGGGGCC
CAGCGTCTGCTGCGGACTGGGCCTGGGGTGCCTGATGGGA
ACGCCGGAAACGGAAGTCTGTCAGAAGGAGAACGAGAGTG
CCGTCCCCTGCGCGATCAGCGGTCGCCACTGCGGCATGGA
CAACACGGGCAACTGTGTGGCTGACGGCATCTGCTGCGTG
GAAGATGCCTGCTCCTTCAACTCGCTGTGCCGAGTGGACA
CTGACCAGGAGGACTCGGTGTCGGCAAGACAAGAGCTGCT
CACGCTCATCCGCCGCCTGCTGGTCAACCGACAGTACGAC

TG
Sequence translation MKCSVLQMSRLSWAMCLMLLMVLLLGTAHGCFIRNCPRGG
KRAVDAVQPTRQCMPCGPDGMGQCVGPSVCCGLGLGCLMG
TPETEVCQKENESAVPCAISGRHCGMDNTGNCVADGICCV
EDACSFNSLCRVDTDQEDSVSARQELLTLIRRLLVNRQYD

References
Kumar,S., Vijayasarathy,M., Venkatesha,M.A., Sunita,P. and Balaram,P. (2020) Cone Snail Analogs of the Pituitary Hormones Oxytocin/Vasopressin and Their Carrier Protein Neurophysin. Proteomic and Transcriptomic Identification of Conopressins and Conophysins Biochim Biophys Acta Proteins Proteom 1868:140391

Internal links
Proteins Encoded conophysin-conopressin Mi precursor

External links
Ncbi
GenBank KY982972.1

Tools