conophysin-conopressin Lo1 precursor (N03057) Nucleic Acid Card

General Information
Name conophysin-conopressin Lo1 precursor
Organism Conus loroisii
Organism Diet vermivorous
Organism Clade X
Organism Region Indo-Pacific
Notes

Sequence
ATGCAGATGGGACGACTGACGTTGGTGCTGTGTTTGCTGC
TACTGCTACTGCTCACTACCCAGGGTTGCTTTATCAGAAA
CTGCCCAAAAGGTGGCAAGAGAGATGTGGACGAAAGACAA
GCTACCAAGGCGTGCATGTCCTGTAGCTTTGGCCAGTGTG
TGGGGCCCCAAATCTGCTGTGGAGCTGGAGGATGCGAAAT
GGGAACCGTAGAAGCGAAGAGGTGCAGCGAAGAGGACGAG
GATCCTATTCCTTGCCAGGTCATTGGTAACCACTGCGCTC
TGGACAACCCAGGCCACTGTGCCGCTTATGGCATCTGCTG
TGTGGATGATACTTGTACCACCCACTCGGGATGTCTG
TA
Sequence translation MQMGRLTLVLCLLLLLLLTTQGCFIRNCPKGGKRDVDERQ
ATKACMSCSFGQCVGPQICCGAGGCEMGTVEAKRCSEEDE
DPIPCQVIGNHCALDNPGHCAAYGICCVDDTCTTHSGCL

References
Kumar,S., Vijayasarathy,M., Venkatesha,M.A., Sunita,P. and Balaram,P. (2020) Cone Snail Analogs of the Pituitary Hormones Oxytocin/Vasopressin and Their Carrier Protein Neurophysin. Proteomic and Transcriptomic Identification of Conopressins and Conophysins Biochim Biophys Acta Proteins Proteom 1868:140391

Internal links
Proteins Encoded conophysin-conopressin Lo1 precursor

External links
Ncbi
GenBank KY982970

Tools