conophysin-conopressin Eb precursor (N03061) Nucleic Acid Card

General Information
Name conophysin-conopressin Eb precursor
Organism Conus ebraeus
Organism Diet vermivorous
Organism Clade XI
Organism Region Indo-Pacific,Eastern Pacific
Notes

Sequence
ATGCAGATGGGGCGACTGACGTTGGTGCTGTGTTTGCTGT
TGCTGCTATTGCTCACTACTCAGGCTTGCTTCATCAGAAA
CTGCCCAAAAGGTGGCAAGAGAGATGTGGACGAAAGACAA
CTTGTGAATGCGTGCATGTTCTGTAGCTTTGGCCAGTGCG
TGGGGCCCCATATCTGCTGTGGAGATGGAGGATGCCAAAT
GGGAACCCCAGAAGCGAGCAGGTGCAGCCAAGAGGACGAG
AGTCCTATTCCTTGCCAAGTCATTGGTAACCACTGCGCTC
TTAACAACCCAGGCAACATCCACGGCCACTGTGTGGCTTA
TGGCATCTGCTGTGTGGATGATACTTGTACCACCCACTCG
GGATGTCTG
TA
Sequence translation MQMGRLTLVLCLLLLLLLTTQACFIRNCPKGGKRDVDERQ
LVNACMFCSFGQCVGPHICCGDGGCQMGTPEASRCSQEDE
SPIPCQVIGNHCALNNPGNIHGHCVAYGICCVDDTCTTHS
GCL

References
Kumar,S., Vijayasarathy,M., Venkatesha,M.A., Sunita,P. and Balaram,P. (2020) Cone Snail Analogs of the Pituitary Hormones Oxytocin/Vasopressin and Their Carrier Protein Neurophysin. Proteomic and Transcriptomic Identification of Conopressins and Conophysins Biochim Biophys Acta Proteins Proteom 1868:140391

Internal links
Proteins Encoded conophysin-conopressin Eb precursor

External links
Ncbi
GenBank KY982966

Tools