conophysin-conopressin Ar precursor (N03062) Nucleic Acid Card

General Information
Name conophysin-conopressin Ar precursor
Organism Conus araneosus
Organism Diet
Organism Clade
Organism Region Indo-Pacific
Notes

Sequence
ATGCAGATGGGACGACCGACGTTGCTGCCGTGTTTGCTGC
TACTGCTAGTGCTCTCTACCCAGGCTTGCTTTATCAGAAA
CTGCCCAAAGGGTGGCAAGAGAAATGTGGACGAAGGACCT
ACCAAACCATGCATGTTCTGTAGCTTTGGCCAGTGTGTGG
GGCCCAATATCTGCTGTGGAGCTAGAGGATGCGAGATGGG
AACCACAGAAGCAAACAGGTGCATCGAAGAGGACGAGGAT
CCTATTCCTTGCTGGGTCTTTGGTGACCACTGCATTCTGA
ACAACCGAGGCAACATCCACGGCAACTGTGTTGCTAATGG
CATCTGCTGTGGGGATGATACTTGTACCACCCACTGGGGA
TGTCTG
TA
Sequence translation MQMGRPTLLPCLLLLLVLSTQACFIRNCPKGGKRNVDEGP
TKPCMFCSFGQCVGPNICCGARGCEMGTTEANRCIEEDED
PIPCWVFGDHCILNNRGNIHGNCVANGICCGDDTCTTHWG
CL

References
Kumar,S., Vijayasarathy,M., Venkatesha,M.A., Sunita,P. and Balaram,P. (2020) Cone Snail Analogs of the Pituitary Hormones Oxytocin/Vasopressin and Their Carrier Protein Neurophysin. Proteomic and Transcriptomic Identification of Conopressins and Conophysins Biochim Biophys Acta Proteins Proteom 1868:140391

Internal links
Proteins Encoded conophysin-conopressin Ar precursor

External links
Ncbi
GenBank KY982965

Tools