Bt5.7 precursor (N03068) Nucleic Acid Card

General Information
Name Bt5.7 precursor
Organism Conus betulinus
Organism Diet vermivorous
Organism Clade X
Organism Region Indo-Pacific
Notes

Sequence
ATGCGTTGTCTCCCAGTCTTCGTCATTCTTCTGTTGCTGA
TTGGATCTGCACCTACCGTTGATGCTCAACCGAAGACCAA
TGATGTGTCCATGGCATCTTTCGACGATAATGCAAAGCGA
ACCCTGCAAATGCTTCGGGGCGTACAAATTTGCTGCCCAT
ACATCCTTTGGTGCTGTTTAATTCCGTAA
Sequence translation MRCLPVFVILLLLIGSAPTVDAQPKTNDVSMASFDDNAKR
TLQMLRGVQICCPYILWCCLIP-

References
Gao,B., Peng,C., Lin,B., Chen,Q., Zhang,J. and Shi,Q. (2017) Screening and Validation of Highly-Efficient Insecticidal Conotoxins from a Transcriptome-Based Dataset of Chinese Tubular Cone Snail Toxins (Basel) 9:214

Internal links
Proteins Encoded Bt5.7 precursor

External links
Ncbi
GenBank KU563944.1

Tools