Bt1.10 precursor (N03069) Nucleic Acid Card

General Information
Name Bt1.10 precursor
Organism Conus betulinus
Organism Diet vermivorous
Organism Clade X
Organism Region Indo-Pacific
Notes

Sequence
ATGTTCACCGTGTTTCTGCTGGTTGTCTTGGCAACCACTG
TGGTTTCCTTCACTTCAGGTCGTGCATTTCGTGGCAGGAA
TCCCGCAGCCAACGACAAAAGGTCTGACCTGGCCGCTCTG
AGCGTCAGGGGAGGATGCTGTTCCCATCCTGCCTGTGGCG
TGAATCATCCAGAGCTTTGTGGCTGA
Sequence translation MFTVFLLVVLATTVVSFTSGRAFRGRNPAANDKRSDLAAL
SVRGGCCSHPACGVNHPELCG-

References
Gao,B., Peng,C., Lin,B., Chen,Q., Zhang,J. and Shi,Q. (2017) Screening and Validation of Highly-Efficient Insecticidal Conotoxins from a Transcriptome-Based Dataset of Chinese Tubular Cone Snail Toxins (Basel) 9:214

Internal links
Proteins Encoded Bt1.10 precursor

External links
Ncbi
GenBank KU563886.1

Tools