Bt1.11 precursor (N03070) Nucleic Acid Card

General Information
Name Bt1.11 precursor
Organism Conus betulinus
Organism Diet vermivorous
Organism Clade X
Organism Region Indo-Pacific
Notes

Sequence
GTGTTTCTGCTGGTTGTCTTGGCAACCACTGTCGTTTCCT
CCACTTCAGGTCGTGCATATGATGGCAGGAATGCTGCCGC
CGACGACAAAGCTTTTGACCTGCTGGCTATGACCATAAGG
GGAGGATGCTGTTCCTATCCTCCCTGTATCGCGAGTAATC
CTAAATGTGGTGGAAGACGCTGA
Sequence translation VFLLVVLATTVVSSTSGRAYDGRNAAADDKAFDLLAMTIR
GGCCSYPPCIASNPKCGGRR-

References
Gao,B., Peng,C., Lin,B., Chen,Q., Zhang,J. and Shi,Q. (2017) Screening and Validation of Highly-Efficient Insecticidal Conotoxins from a Transcriptome-Based Dataset of Chinese Tubular Cone Snail Toxins (Basel) 9:214

Internal links
Proteins Encoded Bt1.11 precursor

External links
Ncbi
GenBank KU564009.1

Tools