Alpha-conotoxin peptides (N00322) Nucleic Acid Card

General Information
Name Alpha-conotoxin peptides
Organism Conus tulipa (tulip cone)
Organism Diet piscivorous
Organism Clade II
Organism Region Indo-Pacific
Notes

Sequence
atgttcaccgtgtttctgttggttgtcttggcaaccactg
tcgtttccttcccttcagatattgcaactgagggcaggaa
tgccgcagccaaagcgtttgacctgatatcttcgatcgtc
aagaaaggatgctgttcccatcctgcctgttcggggaata
atccagaattttgtcgtcaaggtcgc
tgatgctccaggac
cctctgaaccacgacgt
Sequence translation MFTVFLLVVLATTVVSFPSDIATEGRNAAAKAFDLISSIV
KKGCCSHPACSGNNPEFCRQGR

References
Watkins,M., Olivera,B.M., Hillyard,D.R., Mcintosh,M.J. and Jones,R.M. (2002) Alpha-conotoxin peptides JP 2002534996-A 11 22-OCT-2002

Internal links
Proteins Encoded T1.1 precursor

External links
Ncbi
GenBank BD261409

Tools