Alpha-conotoxin peptides (N00355) Nucleic Acid Card

General Information
Name Alpha-conotoxin peptides
Organism Conus consors
Organism Diet piscivorous
Organism Clade I
Organism Region Indo-Pacific
Notes

Sequence
atgttcaccgtgtttctgttggttgtcttggcaaccactg
tcgtttccttcccttcagatcgtgcatctgatggcaggaa
tgccgcagccaacgacaaagcgtctgacgtgatcacgctg
gccctcaagggatgctgttccaaccctgtctgtcacttgg
agcattcaaacctttgtggtagaagacgc
tgatgctccag
gaccctctgaaccacgacgt
Sequence translation MFTVFLLVVLATTVVSFPSDRASDGRNAAANDKASDVITL
ALKGCCSNPVCHLEHSNLCGRRR

References
Watkins,M., Olivera,B.M., Hillyard,D.R., Mcintosh,M.J. and Jones,R.M. (2002) Alpha-conotoxin peptides JP 2002534996-A 11 22-OCT-2002

Internal links
Proteins Encoded Cn1.2 precursor

External links
Ncbi
GenBank BD261442

Tools