Alpha-conotoxin peptides (N00381) Nucleic Acid Card

General Information
Name Alpha-conotoxin peptides
Organism Unknown
Organism Diet
Organism Clade
Organism Region
Notes

Sequence
tctgatggcaggaatgccgcagccaacgacaaagcgtctg
gcatgagcgcgctggccgtcaatgaatgctgtaccaaccc
tgtctgtcacgcggaacatcaagaactttgtgctagaaga
cgc
tga
Sequence translation SDGRNAAANDKASGMSALAVNECCTNPVCHAEHQELCARR
R

References
Watkins,M., Olivera,B.M., Hillyard,D.R., Mcintosh,M.J. and Jones,R.M. (2002) Alpha-conotoxin peptides JP 2002534996-A 11 22-OCT-2002

Internal links
Proteins Encoded Sequence 284 from patent US 6797808

External links
Ncbi
GenBank BD261468

Tools