C.texile KK-0 mRNA for conotoxin (N00004) Nucleic Acid Card

General Information
Name C.texile KK-0 mRNA for conotoxin
Organism Conus textile (Cloth-of-gold cone)
Organism Diet molluscivorous
Organism Clade V
Organism Region Indo-Pacific
Notes

Sequence
aaacatcgccaag
atgaaactgacgtgcatgatgatcgtt
gctgtgctgttcttgaccgcctggacatttgccacggctg
atgaccccagaaatggattggggaatcttttttcgaatgc
acatcacgaaatgaagaaccccgaagcctctaaattgaac
aagaggtggtgcaaacaaagcggtgaaatgtgtaatttgt
tagaccaaaactgctgcgacggctattgcatagtacttgt
ctgcaca
taaaactgccgtgatgtcttctcttcccctctg
tgctacctggcttgatctttgattggcgcgtgtcgttcac
tggttatgaaccccccccccccccccccccccccccttcc
ggctctctggaggcctcgggggttcaacatccaaataaag
tgacag
Sequence translation MKLTCMMIVAVLFLTAWTFATADDPRNGLGNLFSNAHHEM
KNPEASKLNKRWCKQSGEMCNLLDQNCCDGYCIVLVCT

References
Woodward,S.R., Cruz,L.J., Olivera,B.M. and Hillyard,D.R. (1990) Constant and hypervariable regions in conotoxin propeptides EMBO J. 9:1015-1020

Internal links
Proteins Encoded TxVIA precursor

External links
Ncbi
GenBank X53283

Tools