GIC precursor (N00400) Nucleic Acid Card

General Information
Name GIC precursor
Organism Conus geographus (Geography cone)
Organism Diet piscivorous
Organism Clade II
Organism Region Indo-Pacific
Notes

Sequence
tctgatggcaggaatgacgcagccaaagcgtttgacctga
tatcttcgaccgtcaagaaaggatgctgttcccatcctgc
ctgtgcggggaataatcaacatatttgtggccgaagacgc

tgatgctccaggaccctctgaaccacgacgt
Sequence translation SDGRNDAAKAFDLISSTVKKGCCSHPACAGNNQHICGRRR

References
Watkins,M., Olivera,B.M., Hillyard,D.R., Mcintosh,M.J. and Jones,R.M. (2002) Alpha-conotoxin peptides JP 2002534996-A 11 22-OCT-2002

Internal links
Proteins Encoded GIC precursor

External links
Ncbi
GenBank BD261487

Tools