Alpha-conotoxin peptides (N00410) Nucleic Acid Card

General Information
Name Alpha-conotoxin peptides
Organism Conus lividus
Organism Diet vermivorous
Organism Clade VII
Organism Region Indo-Pacific
Notes

Sequence
tctaatggcaggaatgccgcagccaaattcaaagcgcctg
ccctgatgaagcggaccgacagcgaagaatgctgtttaga
ctctcgctgtgccgggcaacatcaagacctgtgtggcgga
agacgc
tgatgctccaggaccctctgaaccacgacgt
Sequence translation SNGRNAAAKFKAPALMKRTDSEECCLDSRCAGQHQDLCGG
RR

References
Watkins,M., Olivera,B.M., Hillyard,D.R., Mcintosh,M.J. and Jones,R.M. (2002) Alpha-conotoxin peptides JP 2002534996-A 11 22-OCT-2002

Internal links
Proteins Encoded Sequence 341 from Patent EP1852440.

External links
Ncbi
GenBank BD261497

Tools