Tau-conotoxin peptides (N00449) Nucleic Acid Card

General Information
Name Tau-conotoxin peptides
Organism Conus marmoreus
Organism Diet molluscivorous
Organism Clade VI
Organism Region Indo-Pacific
Notes

Sequence
atgcgctgcctcccagtcttcgtcattcttctgctgctga
ttgcatctgcacctagcgttgatgcccgaccgaagaccaa
agatgatatgcccctggcatctttccatgataatgcaaag
cgaatcctgcaaatacttcaggacagaaatggttgctgca
gagcaggagactgctgttcacgatttgagataaaggaaaa
tgactttgga
tgagacccctgcaaactgtccttggatgtg
agatttggaaagcagactgttcctttcgcacgtgttcgtg
gaatttcgaatggtcgttaacaacacgctgccacttgcaa
gctactatctctctgtccttttgtctgtggaactgtatga
tcaaacaactgaaatgtcatagaaatttttcagtgggtaa
acactatgaccatgta
Sequence translation MRCLPVFVILLLLIASAPSVDARPKTKDDMPLASFHDNAK
RILQILQDRNGCCRAGDCCSRFEIKENDFG

References
Walker,C., Shetty,R., Olivera,B.M., Hooper,D., Jacobsen,R., Steele,D. and Jones,R.M. (0) Tau-conotoxin peptides

Internal links
Proteins Encoded Mr5.5 precursor

External links
Ncbi
GenBank BD270188

Tools