Conus tulipa isolate tulipa-1 four-loop conotoxin preproprotein mRNA, partial cds (N00461) Nucleic Acid Card

General Information
Name Conus tulipa isolate tulipa-1 four-loop conotoxin preproprotein mRNA, partial cds
Organism Conus tulipa (tulip cone)
Organism Diet piscivorous
Organism Clade II
Organism Region Indo-Pacific
Notes

Sequence
c
tgtcagctcatcacagctctggactccaaaggtatggag
aagcgtcgtgccttgaggtcgaccaccaaactctccaagc
tgaggcaggtttcttggtggtgcgggaaacccgaagctac
atgtggaaagctatatctaaaatgctgctccggtatgtgc
aataaagccaactggaaatgtttacgc
taatccagcacct
gctcttccccattctgtgctctatccctctctg
Sequence translation CQLITALDSKGMEKRRALRSTTKLSKLRQVSWWCGKPEAT
CGKLYLKCCSGMCNKANWKCLR

References
Duda,T.F. Jr. and Palumbi,S.R. (0) Convergent evolution of venoms and feeding ecologies among polyphyletic piscivorous Conus species

Internal links
Proteins Encoded T6.1 precursor

External links
Ncbi
GenBank AF480316

Tools