Sequence 5 from patent US 5719264 (N00463) Nucleic Acid Card

General Information
Name Sequence 5 from patent US 5719264
Organism Unknown
Organism Diet
Organism Clade
Organism Region
Notes

Sequence
atgaaactgacgtgcatgatgatcgttgctgtgctgttct
tgacagcctggacgctcgtcatggctgatgactccaacaa
tggactggcgaatcattttttgaaatcacgtgacgaaatg
gaggaccccgaagcttctaaattggagaaaagggcgtgca
gcaaaaaatgggaatattgtatagtaccgatccttggatt
cgtatattgctgccctggcttaatctgtggtcctttcgtc
tgcgtt
tgatagtga
Sequence translation MKLTCMMIVAVLFLTAWTLVMADDSNNGLANHFLKSRDEM
EDPEASKLEKRACSKKWEYCIVPILGFVYCCPGLICGPFV
CV

References
Shon,K.-J., Olivera,B.M., McIntosh,J.Michael., Hasson,A. and Spira,M.E. (1998) Conotoxin peptides Patent: US 5719264 17-FEB-1998

Internal links
Proteins Encoded MrVIB precursor

External links
Ncbi
GenBank I88958

Tools