Conus ermineus clone 2 four-loop conotoxin mRNA, partial cds (N00466) Nucleic Acid Card

General Information
Name Conus ermineus clone 2 four-loop conotoxin mRNA, partial cds
Organism Conus ermineus (Atlantic fish-hunting cone)
Organism Diet piscivorous
Organism Clade III
Organism Region Eastern Atlantic and Mediterranean,Western Atlantic and Caribbean
Notes

Sequence
t
gtggtgatcgtcgccgtgctgttcctgacggcctgtcaa
ctcatcacagctgatgactccagacgtacgcagaagcatc
gtgccctgaggtcgaccaccaaactctccatgttgactcg
gcaatgcacgcctcacggaggatcttgtggtttggttagt
acgtgctgcggtagatgcagtgtaccaagaaataaatgtg
aa
tagctgatccggcgtctgatcttcccccttctgtgctg
tatccttttctg
Sequence translation VVIVAVLFLTACQLITADDSRRTQKHRALRSTTKLSMLTR
QCTPHGGSCGLVSTCCGRCSVPRNKCE

References
Duda,T.F. Jr. and Palumbi,S.R. (0) Convergent evolution of venoms and feeding ecologies among polyphyletic piscivorous Conus species

Internal links
Proteins Encoded E6.2 precursor

External links
Ncbi
GenBank AY236863

Tools