Sequence 9 from patent US 5739276 (N00469) Nucleic Acid Card

General Information
Name Sequence 9 from patent US 5739276
Organism Unknown
Organism Diet
Organism Clade
Organism Region
Notes

Sequence
atgaaactgacgtgcgtgatgatcgttgctgtgctgttct
tgactgcctggacattcgtcacggctgatgactccaaaaa
tggactggagaatcatttttggaaggcacgtgacgaaatg
aagaaccgcgaagcctctaaattggacaaaaaggaagcct
gctatgcgcctggtactttttgtggcataaagcccgggct
atgctgcagtgagttttgtctcccgggcgtctgcttcggt
ggt
Sequence translation MKLTCVMIVAVLFLTAWTFVTADDSKNGLENHFWKARDEM
KNREASKLDKKEACYAPGTFCGIKPGLCCSEFCLPGVCFG
G

References
Shon,K.-J., Grilley,M.M. and Olivera,B.M. (1998) Conotoxin peptides Patent: US 5739276 14-APR-1998

Internal links
Proteins Encoded PVIA precursor

External links
Ncbi
GenBank AR001414

Tools