Sequence 26 from patent US 6630573 (N00473) Nucleic Acid Card

General Information
Name Sequence 26 from patent US 6630573
Organism Unknown
Organism Diet
Organism Clade
Organism Region
Notes

Sequence
aattcggaagctgactacaagcaga
atgtactgtctccca
gtcttcatcattcttctgctgctgatttcatctgcaccta
gcactcctccccaaccaaggaacaaagatcgtgtgcacct
gatatctttactcgataatcacaagcaaatcctacaaaga
gattggaacagttgctgtgggaaaaatcctggttgctgtc
cttggggaaaa
tgactttggatgagacccctgcaaactgt
ccctggatgtgagatttggaaagcagaccgtttgtggaat
tttgaatggtcgttaacaacacgctgccacttgcaagcta
caatctctctgtcctttcatctttggaactggatgatcaa
acaactgaaatgtcatagaaatttttcaatgggtatacaa
tatgtgggcatttagtcagtaattacatcatttgg
Sequence translation MYCLPVFIILLLLISSAPSTPPQPRNKDRVHLISLLDNHK
QILQRDWNSCCGKNPGCCPWGK

References
Walker,C., Shetty,R., Olivera,B.M., Hooper,D., Jacobsen,R., Steele,D. and Jones,R. (2003) Tau-conotoxin peptides Patent: US 6630573 07-OCT-2003

Internal links
Proteins Encoded Im5.1 precursor

External links
Ncbi
GenBank AR406133

Tools