Conus ventricosus clone VnMLKM-02 conotoxin scaffold III/IV precursor, mRNA, complete cds (N00049) Nucleic Acid Card

General Information
Name Conus ventricosus clone VnMLKM-02 conotoxin scaffold III/IV precursor, mRNA, complete cds
Organism Conus ventricosus
Organism Diet molluscivorous
Organism Clade
Organism Region Eastern Atlantic and Mediterranean
Notes

Sequence
gaggctcgtg
atgttgaaaatgggagtggtgctattcatc
tttctggtcctgtttaccctggcaacgctccagctggatg
cagatcaacctgtagaacgatatgcggagaacaaacagct
cctgagcccagatgaaaggagggatatcatattgcatgct
ctggggcagcggagatgctgtgatccggattggtgcgatg
caggttgttacgacggctgctgc
taggactagcgcccaac
atccatggcgctgtgctgggtggttatatccgcaacgaca
gcgtttgtagatttcatatatcattgcgcccacgtctctt
gtctaagaaa
Sequence translation MLKMGVVLFIFLVLFTLATLQLDADQPVERYAENKQLLSP
DERRDIILHALGQRRCCDPDWCDAGCYDGCC

References
Conticello,S.G., Gilad,Y., Avidan,N., Ben-Asher,E., Levy,Z. and Fainzilber,M. (2001) Mechanisms for evolving hypervariability: the case of conopeptides Mol. Biol. Evol. 18:120-131

Internal links
Proteins Encoded Vn3.6 precursor

External links
Ncbi
GenBank AF214949

Tools