Conus miles tau conotoxin Mi T-1 mRNA, complete cds (N00492) Nucleic Acid Card

General Information
Name Conus miles tau conotoxin Mi T-1 mRNA, complete cds
Organism Conus miles
Organism Diet vermivorous
Organism Clade XII
Organism Region Indo-Pacific
Notes

Sequence
atgcgctgtgtcccagtcttcatcattcttctgttgctga
ttccatctgcatctagcgttgatgtccaaccgttgaccag
agatgatgtgcccctggcatctttcctcgatgatgcaagg
cgaaccctgcgaagtccctggatgacacgcagatgctgtc
caggaaattttgcgtgctgtggaaaa
tgaagagaaatgat
tttggatgagacccctgcaaactgtccctggatgtgagat
ttggaaagcagactgttcctttcgcacgtgctcgtgggat
ttcgaacggtcgttaacaacacgctgcctcttgcaagcta
ttatctctctgtcctttcatctgtgaaactggacgatttg
acaactgaaatgtcatagagatttttttaatggatatact
ttatgaccatgtagttagtaattacatcatttggactttc
tgaaatatttgtcaaaatgtacatgttttcccttggaaag
gtcctttgtgattttatgtattaggatgttattttttcac
agaaattatgggaatgctgtctttctttttgttcccacat
caatgggtgtggggcaaaaaaatggtttggtcttgggcca
atgtaattatgaacctggcntttc
Sequence translation MRCVPVFIILLLLIPSASSVDVQPLTRDDVPLASFLDDAR
RTLRSPWMTRRCCPGNFACCGK

References

Internal links
Proteins Encoded Mi5.2 precursor

External links
Ncbi
GenBank AY580326

Tools