Conus quercinus alpha conotoxin QC1.4 mRNA, complete cds (N00494) Nucleic Acid Card

General Information
Name Conus quercinus alpha conotoxin QC1.4 mRNA, complete cds
Organism Conus quercinus
Organism Diet vermivorous
Organism Clade VII
Organism Region Indo-Pacific
Notes

Sequence
atgggcatgcggatgatgttcacagtgtttctgttggttg
tcttggcaaccactgtcacttcagatcgtgtatctaatgg
caggaaagctgcagccaaactcaaagcgcctgccctgatg
gagctgtccgtcaggcaaggatgctgttcagatcctgcct
gtgccgtgagcaatccagacatctgtggcggaggacgc
tg
atgctccaggaccctctgaaccacgac
Sequence translation MGMRMMFTVFLLVVLATTVTSDRVSNGRKAAAKLKAPALM
ELSVRQGCCSDPACAVSNPDICGGGR

References

Internal links
Proteins Encoded Qc1.4 precursor

External links
Ncbi
GenBank AY588973

Tools