Conus leopardus tau conotoxin 5.1 mRNA, complete cds (N00502) Nucleic Acid Card

General Information
Name Conus leopardus tau conotoxin 5.1 mRNA, complete cds
Organism Conus leopardus
Organism Diet vermivorous
Organism Clade
Organism Region Indo-Pacific
Notes

Sequence
atgcgctgtgtcccagtcttcatcattcttctgctgctga
ttccatctgcacccagcgttgatgcccaacggaagaccaa
agatgatgtgcccctggcatctttccatgataatgcaaag
cgaaccctgaaaagactttggaacaaacgctcgtgctgcc
cacaagaatttttatgctgtctatacctggtgaaa
tgact
ttgggtgagactcctgcgaactgtccctagatgtgagatt
tggaaagcagactgttccttttgtgtgttttcgtggaatt
tcgaatggtcgtcaacaacattctgccacttgcaagctat
tatctctttgtcctttcatatgtggaaatggatgacctaa
caactgaaatgtcatggaaatttttcaatgggtatacact
atgaccatgtagtcggaaattgcatcgtttggactttttg
gaatatttttcaaaatgtagtaagtttttttttttccttt
ggaaaggtcctttgtgattaaatatttcagtatgttatgc
tttgcacacaagctatagaatgctatctttctttttgtta
ccatatcaatgatggggcccnaaaaatcattgggttttgg
gcctatgtaaatttatgacctggcattaagtggcttat
Sequence translation MRCVPVFIILLLLIPSAPSVDAQRKTKDDVPLASFHDNAK
RTLKRLWNKRSCCPQEFLCCLYLVK

References
Chen,W.H., Han,Y.H., Wang,Q., Miao,X.W., Ou,L. and Shao,X.X. (2006) cDNA cloning of two novel T-superfamily conotoxins from Conus leopardus Acta Biochim. Biophys. Sin. (Shanghai) 38:287-291

Internal links
Proteins Encoded Lp5.1 precursor

External links
Ncbi
GenBank AY591769

Tools