Conus textile O-superfamily conotoxin TxO5 precursor, mRNA, complete cds (N00516) Nucleic Acid Card

General Information
Name Conus textile O-superfamily conotoxin TxO5 precursor, mRNA, complete cds
Organism Conus textile (Cloth-of-gold cone)
Organism Diet molluscivorous
Organism Clade V
Organism Region Indo-Pacific
Notes

Sequence
atgaaactgacgtgcatggtgatcgttgctgtgctgttct
tgaccgcctggacattcgtcacggccatcaccagcaatgg
attggagaatctttttccgaatgcacatcacgaaatgaag
aaccctgaagcctctaaattgaacaagaggtgcgttccat
acgagggcccttgtaattggcttacacaaaactgctgtga
tgcaacatgcgtagtattttggtgccta
taaaactaccgt
gatgtcttctactcccctctgtgctacctggcttgatctt
tgattggcgcgtgcctttcactggttatgaaccccctgat
ccgactctctggcggcctcgggggttcaacatccaaataa
a
Sequence translation MKLTCMVIVAVLFLTAWTFVTAITSNGLENLFPNAHHEMK
NPEASKLNKRCVPYEGPCNWLTQNCCDATCVVFWCL

References
Lu,B.S., Yu,F., Zhao,D., Huang,P.T. and Huang,C.F. (1999) Conopeptides from Conus striatus and Conus textile by cDNA cloning Peptides 20:1139-1144

Internal links
Proteins Encoded TxO5 precursor

External links
Ncbi
GenBank AF146358

Tools