Conus pulicarius conotoxin PuIA precursor (puIA) mRNA, complete cds (N00519) Nucleic Acid Card

General Information
Name Conus pulicarius conotoxin PuIA precursor (puIA) mRNA, complete cds
Organism Conus pulicarius
Organism Diet vermivorous
Organism Clade XIV
Organism Region Indo-Pacific
Notes

Sequence
atgaaactgacgtgtgtgatgatcgttgctgtgctgttct
tgaccgcctggacattcgtcacggctgactccatacgtgc
actggaggatctttttgcgaaggcacctgacgaaatggaa
aacagcggagcttctccattgaacgagagagactgccgac
ctgtaggtcaatattgtggcataccgtatgagcacaactg
gcgatgctgcagtcagctttgtgcaattatctgtgtttcc

taa
Sequence translation MKLTCVMIVAVLFLTAWTFVTADSIRALEDLFAKAPDEME
NSGASPLNERDCRPVGQYCGIPYEHNWRCCSQLCAIICVS

References

Internal links
Proteins Encoded PuIA precursor

External links
Ncbi
GenBank AF132129

Tools