Sequence 120 from patent US 6797808 (N00563) Nucleic Acid Card

General Information
Name Sequence 120 from patent US 6797808
Organism Unknown
Organism Diet
Organism Clade
Organism Region
Notes

Sequence
atgttcaccgtgtttctgttggttgtcttggcaaccactg
tcgtttccttcccttcagatcgtgcatctgatggcaggaa
tgccgcagccagcgacagagcgtctgacgcggcccaccag
ggatgctgttccaaccctgtctgtcacgtggaacatccag
aactttgtcgtagaagacgc
tgatgctccaggaccctctg
aaccacgacg
Sequence translation MFTVFLLVVLATTVVSFPSDRASDGRNAAASDRASDAAHQ
GCCSNPVCHVEHPELCRRRR

References
Watkins,M., Olivera,B.M., Hillyard,D.R., McIntosh,J.M. and Jones,R.M. (2002) Alpha-conotoxin peptides JP 2002534996-A 11 22-OCT-2002

Internal links
Proteins Encoded Ci1.1 precursor

External links
Ncbi
GenBank AR584833

Tools