Conus textile clone TxMRCL-012 conotoxin scaffold IX precursor, mRNA, complete cds (N00058) Nucleic Acid Card

General Information
Name Conus textile clone TxMRCL-012 conotoxin scaffold IX precursor, mRNA, complete cds
Organism Conus textile (Cloth-of-gold cone)
Organism Diet molluscivorous
Organism Clade V
Organism Region Indo-Pacific
Notes

Sequence
ctggcaggtactcaacgaacttcaggacacattcttttca
cctggacacgggaagctgactacaagcaga
atgcgctgtt
tcccagtcttcatcattcttctgctgctaattgcatctgc
accttgctttgatgcccgaacgaagaccgatgatgatgtg
cccctgtcatctctccgcgataatctaaaacgaacgatac
gaacacgcctgaacatacgcgagtgctgcgaggatggatg
gtgctgtactgctgcacccttaacaggtcgt
taggaaaat
ggctttggatgagacccctgcgaattgtccctggatgtga
gatttggaaagcagactgttcctttcgcacgtgttcgtgg
aatttcgaatggtcgttaacaacacgctgccacttgcaag
ccactatctctctgtcctttcgtatgtggaactgtatgat
ctaacaactgaaatgtcagaaagttttcagtgggtataca
ctatgatcgtatagtcagtaattacatcatttggactttc
tgaaatatttttcgaaatgtgttttcccttgtaaaggtcc
ttagtaattatattttagtgtgttatgttttccatacaag
ttatagaatgctgtctttccttttgttcccacatcaatgg
tggggacataaattattggttttgatcaatgtaattatga
cctgcatttgtgctatagtgactgcattttcagcgttaaa
tgtttaatctgcaaacagaaaaaaggttggtcgactaata
aagacttgcatggcacagttaaaaaaaaaaaaaaaaaa
Sequence translation MRCFPVFIILLLLIASAPCFDARTKTDDDVPLSSLRDNLK
RTIRTRLNIRECCEDGWCCTAAPLTGR

References
Conticello,S.G., Gilad,Y., Avidan,N., Ben-Asher,E., Levy,Z. and Fainzilber,M. (2001) Mechanisms for evolving hypervariability: the case of conopeptides Mol. Biol. Evol. 18:120-131

Internal links
Proteins Encoded TxVA precursor

External links
Ncbi
GenBank AF214958

Tools