Sequence 251 from patent US 6797808 (N00589) Nucleic Acid Card

General Information
Name Sequence 251 from patent US 6797808
Organism Unknown
Organism Diet
Organism Clade
Organism Region
Notes

Sequence
atcaagaatacagcagccagcaacaaagcgtctagcctgg
tggctcttgttgtcaggggatgctgttacaatcctgtctg
caagaaatattattgttggaaaggc
tgatgctccaggacc
ctctgaaccacgacgt
Sequence translation IKNTAASNKASSLVALVVRGCCYNPVCKKYYCWKG

References
Watkins,M., Olivera,B.M., Hillyard,D.R., McIntosh,J.M. and Jones,R.M. (2002) Alpha-conotoxin peptides JP 2002534996-A 11 22-OCT-2002

Internal links
Proteins Encoded Sequence 252 from patent US 6797808

External links
Ncbi
GenBank AR584859

Tools