Sequence 343 from patent US 6797808 (N00635) Nucleic Acid Card

General Information
Name Sequence 343 from patent US 6797808
Organism Unknown
Organism Diet
Organism Clade
Organism Region
Notes

Sequence
tctgatggcaggaatgccgcagccaaggacaaagcgtctg
acctggtcgctctgaccgtcaagggatgctgttctaatcc
tccctgttacgcgaataatcaagcctattgtaatggaaga
cgc
tga
Sequence translation SDGRNAAAKDKASDLVALTVKGCCSNPPCYANNQAYCNGR
R

References
Watkins,M., Olivera,B.M., Hillyard,D.R., McIntosh,J.M. and Jones,R.M. (2002) Alpha-conotoxin peptides JP 2002534996-A 11 22-OCT-2002

Internal links
Proteins Encoded Sequence 344 from patent US 6797808

External links
Ncbi
GenBank AR584905

Tools