Conus ventricosus clone VnMRCL-03 conotoxin scaffold IX precursor, mRNA, complete cds (N00065) Nucleic Acid Card

General Information
Name Conus ventricosus clone VnMRCL-03 conotoxin scaffold IX precursor, mRNA, complete cds
Organism Conus ventricosus
Organism Diet molluscivorous
Organism Clade
Organism Region Eastern Atlantic and Mediterranean
Notes

Sequence
tggcaggtactcaacgaacttcaggacacattctttttca
cctggacacgggaagccgactacaagcaga
atgcgctgtc
tcccagtcttcgtcattcttctgctgttgattgcatctgc
acctggcgttgatgattttgcgaagaaaaccccaaaaaga
ctttcgaaaccacgtgactgctgccgcagaaatttcttat
gttgt
taaaaagaaacgaaatggtcttatttcaggatgaa
gggaaatgactttggatgagacccctgcaaactgtccctg
gatgtgagatttggaagcagactgttcctttcgcgcgtgt
tcgtggaatttcgaatggtcgc
Sequence translation MRCLPVFVILLLLIASAPGVDDFAKKTPKRLSKPRDCCRR
NFLCC

References
Conticello,S.G., Gilad,Y., Avidan,N., Ben-Asher,E., Levy,Z. and Fainzilber,M. (2001) Mechanisms for evolving hypervariability: the case of conopeptides Mol. Biol. Evol. 18:120-131

Internal links
Proteins Encoded Vn5.1 precursor

External links
Ncbi
GenBank AF214965

Tools