Conus lividus isolate 2 clone 10a four-loop conotoxin LVVIIB mRNA, partial cds (N00668) Nucleic Acid Card

General Information
Name Conus lividus isolate 2 clone 10a four-loop conotoxin LVVIIB mRNA, partial cds
Organism Conus lividus
Organism Diet vermivorous
Organism Clade VII
Organism Region Indo-Pacific
Notes

Sequence
c
gtgttgatcatcgccgtgctgttcctggcggctagtgag
ctcgttacagcagattacaccagagatgagtggcagtacc
gtgcagcgagtttgagagacgcaatgcggaatttcagaga
taccaggtgctcgccaggaggtgaagtttgcactagacac
agcccttgctgcactggattcctttgcaatcacatcggag
gcatgtgccaccac
tagcaacagtctggcatctgatattt
cccctctgcgctccaccctgtattggctgattcatcctta
cctgtgtgtggtcatgaaccactcagtagctacacctctt
ttg
Sequence translation VLIIAVLFLAASELVTADYTRDEWQYRAASLRDAMRNFRD
TRCSPGGEVCTRHSPCCTGFLCNHIGGMCHH

References
Duda,T.F. Jr. and Palumbi,S.R. (1999) Molecular genetics of ecological diversification: duplication and rapid evolution of toxin genes of the venomous gastropod Conus Proc. Natl. Acad. Sci. U.S.A. 96:6820-6823

Internal links
Proteins Encoded LvVIIB precursor 2

External links
Ncbi
GenBank AF089903

Tools