Conus pennaceus clone PnMRCL-0112 conotoxin scaffold IX precursor, mRNA, complete cds (N00071) Nucleic Acid Card

General Information
Name Conus pennaceus clone PnMRCL-0112 conotoxin scaffold IX precursor, mRNA, complete cds
Organism Conus pennaceus
Organism Diet molluscivorous
Organism Clade V
Organism Region Indo-Pacific
Notes

Sequence
cttcagaacacattcttttcacctggacacgggaaactga
caacaagcaga
atgcactgcctctcagtcttcgtcattct
tctgctgctgactgcatctgcacctagcgttgatgcccaa
ccgaagaccgaagatgatgtgcccctgtcatctttccacg
atgatctacagcgaaccgtacgaacacttctggacatacg
catgtgctgccttggtacttcagggtgctgtccttgggga

taaaggaaaatgactttggatgatacccctgcgaactgtt
cctggatgtgagatttggaaagcagactgttcctttcgcg
cgtattcgtggaatttcgaatggtcgttaacaacatgctg
ccacttgcaagctacaatctctctgtcctttcatatgatc
aaacaactgaaatgtcatacaaagtttccagtgggtatac
actatgatggtgtagtcagtaattacatcatttggacttt
ntgaaatatttttcgaaatgtaaatgttntccctcnnaaa
ggtcctttgnaantatatattttagagtgtnatgntttcc
atacaaattatagaatgctgtctttccttttgttcccaca
tcaatggtgggggcagaaattattggtttttgtcaatgta
attatgacctgcatttaatgctatagtgattgctttttta
gcgttgaatgtttaatctgcaaacggaaaaaggttgatcg
actaataaagacttgcatggcacagttaaaaaaaaaaaaa
aaaa
Sequence translation MHCLSVFVILLLLTASAPSVDAQPKTEDDVPLSSFHDDLQ
RTVRTLLDIRMCCLGTSGCCPWG

References
Conticello,S.G., Gilad,Y., Avidan,N., Ben-Asher,E., Levy,Z. and Fainzilber,M. (2001) Mechanisms for evolving hypervariability: the case of conopeptides Mol. Biol. Evol. 18:120-131

Internal links
Proteins Encoded Pn-0111 precursor

External links
Ncbi
GenBank AF214971

Tools