Conus abbreviatus isolate 2 clone 3 four-loop conotoxin ABVIO mRNA, partial cds (N00832) Nucleic Acid Card

General Information
Name Conus abbreviatus isolate 2 clone 3 four-loop conotoxin ABVIO mRNA, partial cds
Organism Conus abbreviatus
Organism Diet vermivorous
Organism Clade
Organism Region Indo-Pacific
Notes

Sequence
c
gtgataatcatcgccgtgctgttcctgacggcctgtcaa
ctcattgcaacagcgagttacgccagaagtgagcggaagc
atcctgatctgaggttgagcagccgaaactctaagttaag
caagcgttgcctaggaagtcgtgaactatgtgtgcgtgat
acttcctgctgcagcatgtcctgcaccaacaacatctgct
tc
taaagctggtccggcgtctgacaattccccttccgtgc
tccatcctctttttttg
Sequence translation VIIIAVLFLTACQLIATASYARSERKHPDLRLSSRNSKLS
KRCLGSRELCVRDTSCCSMSCTNNICF

References
Duda,T.F. Jr. and Palumbi,S.R. (1999) Molecular genetics of ecological diversification: duplication and rapid evolution of toxin genes of the venomous gastropod Conus Proc. Natl. Acad. Sci. U.S.A. 96:6820-6823

Internal links
Proteins Encoded ABVIO precursor

External links
Ncbi
GenBank AF090067

Tools