Conus tessulatus clone TsMRCL-05 conotoxin scaffold IX precursor, mRNA, complete cds (N00085) Nucleic Acid Card

General Information
Name Conus tessulatus clone TsMRCL-05 conotoxin scaffold IX precursor, mRNA, complete cds
Organism Conus tessulatus
Organism Diet vermivorous
Organism Clade XVI
Organism Region Indo-Pacific
Notes

Sequence
gttcaggacacattcttttcacgtggacacgggaaactga
taacaagcaga
atgcactgcctcccagtcctcgtcattct
tctgctgctgattgcatctacacctagcgttgatgctcga
ccgaaccctaaagatgatgtgcccctggcatctttccacg
gtgcagttaatgcgaagcgatacctacgaacactttggaa
ctcacgtgactgctgcgatcctaaagaaccytgctgtttt
attgga
tgatcgactgaaaacgtgcatttgtactttggat
gagacccctncgaactgtccctggatgtgagatttggaaa
gcagactgttcctttcgcgtgtgttcgtggaatttcgaat
ggtcgt
Sequence translation MHCLPVLVILLLLIASTPSVDARPNPKDDVPLASFHGAVN
AKRYLRTLWNSRDCCDPKE?CCFIG

References
Conticello,S.G., Gilad,Y., Avidan,N., Ben-Asher,E., Levy,Z. and Fainzilber,M. (2001) Mechanisms for evolving hypervariability: the case of conopeptides Mol. Biol. Evol. 18:120-131

Internal links
Proteins Encoded Ts5.2 precursor

External links
Ncbi
GenBank AF214985

Tools