Conus striatus mRNA for four-loop conotoxin preproprotein, clone 12 (N00851) Nucleic Acid Card

General Information
Name Conus striatus mRNA for four-loop conotoxin preproprotein, clone 12
Organism Conus striatus (Striated cone)
Organism Diet piscivorous
Organism Clade I
Organism Region Indo-Pacific
Notes

Sequence
atgaaactgacgtgtgtggtgatcgtcgccgtgctgctcc
tgacggcctgtcaactcatcacagctgatgactccagagg
tacgcagaagcatcgttccctgaggtcgaccaccaaagtc
tccaaggcgactgactgcattgaagccggaaattattgcg
gacctactgttatgaaaatctgctgcggcttttgcagtcc
atacagcaaaatatgtatgaactatcccaaaaat
tga
Sequence translation MKLTCVVIVAVLLLTACQLITADDSRGTQKHRSLRSTTKV
SKATDCIEAGNYCGPTVMKICCGFCSPYSKICMNYPKN

References
Kauferstein,S., Melaun,C. and Mebs,D. (2005) Direct cDNA cloning of novel conopeptide precursors of the O-superfamily Peptides 26:361-367

Internal links
Proteins Encoded SO4 precursor

External links
Ncbi
GenBank AJ851172

Tools