Conus imperialis mRNA for four-loop conotoxin prepropeptide, clone 6 (N00865) Nucleic Acid Card

General Information
Name Conus imperialis mRNA for four-loop conotoxin prepropeptide, clone 6
Organism Conus imperialis
Organism Diet vermivorous
Organism Clade XVII
Organism Region Indo-Pacific
Notes

Sequence
atgaaactgacgtgcatgatgatcgttgctgtgctgttct
tgaccgcctggatattcatcacggctgataactccagaaa
tggaatcgagaaccttcctcggatgagacgtcacgaaatg
aagaaccccaaagcctctaaattgaacaagagagggtgcc
gtgaaggaggtgaattttgtggcacgctgtatgaagaaag
atgctgcagtggctggtgctttttcgtctgcgtg
taa
Sequence translation MKLTCMMIVAVLFLTAWIFITADNSRNGIENLPRMRRHEM
KNPKASKLNKRGCREGGEFCGTLYEERCCSGWCFFVCV

References
Kauferstein,S., Melaun,C. and Mebs,D. (2005) Direct cDNA cloning of novel conopeptide precursors of the O-superfamily Peptides 26:361-367

Internal links
Proteins Encoded Conotoxin-5 precursor

External links
Ncbi
GenBank AJ851186

Tools