Conus quercinus M conotoxin Qc3.1 mRNA, complete cds (N00873) Nucleic Acid Card

General Information
Name Conus quercinus M conotoxin Qc3.1 mRNA, complete cds
Organism Conus quercinus
Organism Diet vermivorous
Organism Clade VII
Organism Region Indo-Pacific
Notes

Sequence
atgttgaaaatgggagtggtgctattcacctttctggtcc
tgtttcccctggcaacgctccagctggatgcagatcaacc
tgcagcacgatatgcagagaacaaacaggacctcaaccca
aatgaaaggaaggaaatgatgttgtctgctctgaggcagc
gggcatgctgtgatcctgactggtgcgacgcaggttgtta
tgatgggtgctgc
tagtagcgcccaacatccatggcggtg
tgctgggcggttttatccacaacgacagcgtttgttgatc
tcatgtattatcgcgcacatacctttctaagaatgacgaa
catgattacactctagttcagatttcgtgttcttttctga
caataaatgactaaactccaaaaaaaaaa
Sequence translation MLKMGVVLFTFLVLFPLATLQLDADQPAARYAENKQDLNP
NERKEMMLSALRQRACCDPDWCDAGCYDGCC

References
Han,Y.H., Wang,Q., Jiang,H., Liu,L., Xiao,C., Yuan,D.D., Shao,X.X., Dai,Q.Y., Cheng,J.S. and Chi,C.W. (2006) Characterization of novel M-superfamily conotoxins with new disulfide linkage FEBS J. 273:4972-4982

Internal links
Proteins Encoded Qc3.1 precursor

External links
Ncbi
GenBank AY880685

Tools