Conus capitaneus partial mRNA for conotoxin (N00877) Nucleic Acid Card

General Information
Name Conus capitaneus partial mRNA for conotoxin
Organism Conus capitaneus
Organism Diet vermivorous
Organism Clade XII
Organism Region Indo-Pacific
Notes

Sequence
atgatgtttcgattgacgtcagtcagctgtttcctgctgg
tcatcgcttgtctgaacttgtttcaggttgtacttaccag
acgctgcttccctccaggagtgtactgcacaagacatctc
ccctgctgtcgtggaaggtgctgttctgggtggtgcagac
caaggtgtttcccaaggtatggaaagagggcgacattcca
a
Sequence translation MMFRLTSVSCFLLVIACLNLFQVVLTRRCFPPGVYCTRHL
PCCRGRCCSGWCRPRCFPRYGKRATFQ

References
Kauferstein,S., Huys,I., Kuch,U., Melaun,C., Tytgat,J. and Mebs,D. (2004) Novel conopeptides of the I-superfamily occur in several clades of cone snails Toxicon 44:539-548

Internal links
Proteins Encoded Cp1.1 precursor

External links
Ncbi
GenBank AJ746187

Tools