Conus striatus partial mRNA for conotoxin (N00878) Nucleic Acid Card

General Information
Name Conus striatus partial mRNA for conotoxin
Organism Conus striatus (Striated cone)
Organism Diet piscivorous
Organism Clade I
Organism Region Indo-Pacific
Notes

Sequence
atgatgtttcgattgacgtcagtcagctgtttcctgctgg
tcatcgtttgtctgaacttgtttcaggttgtgcttaccag
acgctgcgtccctccatcaaggtactgcacaagacatcgc
ccctgctgtcgtggaacgtgctgttctgggttgtgcagac
caatgtgtaatctatggtatggaaagagggcgacattcca
agaa
Sequence translation MMFRLTSVSCFLLVIVCLNLFQVVLTRRCVPPSRYCTRHR
PCCRGTCCSGLCRPMCNLWYGKRATFQE

References
Kauferstein,S., Huys,I., Kuch,U., Melaun,C., Tytgat,J. and Mebs,D. (2004) Novel conopeptides of the I-superfamily occur in several clades of cone snails Toxicon 44:539-548

Internal links
Proteins Encoded S11.3 precursor

External links
Ncbi
GenBank AJ746188

Tools