Conus miles mRNA for conotoxin (N00879) Nucleic Acid Card

General Information
Name Conus miles mRNA for conotoxin
Organism Conus miles
Organism Diet vermivorous
Organism Clade XII
Organism Region Indo-Pacific
Notes

Sequence
atgatgttgcgattgacgtcagtcagctgtttcctgctgg
tcatcgcttgtctgaacttgtttcaggttgtgctgaccag
acgctgcttccctccaggaacgttctgctcaagatatctc
ccctgctgtagtggaaggtgctgttctgggtggtgcacac
gaaggtgttctccaaggtatggaaagagggcgacattcca
agaa
tga
Sequence translation MMLRLTSVSCFLLVIACLNLFQVVLTRRCFPPGTFCSRYL
PCCSGRCCSGWCTRRCSPRYGKRATFQE

References
Kauferstein,S., Huys,I., Kuch,U., Melaun,C., Tytgat,J. and Mebs,D. (2004) Novel conopeptides of the I-superfamily occur in several clades of cone snails Toxicon 44:539-548

Internal links
Proteins Encoded Mi11.1 precursor

External links
Ncbi
GenBank AJ746189

Tools