Conus vexillum mRNA for I-superfamily conotoxin, clone 2 (N00881) Nucleic Acid Card

General Information
Name Conus vexillum mRNA for I-superfamily conotoxin, clone 2
Organism Conus vexillum
Organism Diet vermivorous
Organism Clade XII
Organism Region Indo-Pacific
Notes

Sequence
atgatgtttcgattgacgtcagtcagctgtttcctgctgg
tcatcgcttgtctgaacttgtttcaggttgtgcttaccag
ccgctgcttccctccaggaatatactgcacaccctatctc
ccctgctgttggggaatttgctgtgatacgtgcagaaatg
tgtgtcatttgaggtttggaaagagggcgacattccaaga
a
tga
Sequence translation MMFRLTSVSCFLLVIACLNLFQVVLTSRCFPPGIYCTPYL
PCCWGICCDTCRNVCHLRFGKRATFQE

References
Kauferstein,S., Huys,I., Kuch,U., Melaun,C., Tytgat,J. and Mebs,D. (2004) Novel conopeptides of the I-superfamily occur in several clades of cone snails Toxicon 44:539-548

Internal links
Proteins Encoded Vx11.2 precursor

External links
Ncbi
GenBank AJ748255

Tools