Sequence 48 from patent US 6855805 (N00892) Nucleic Acid Card

General Information
Name Sequence 48 from patent US 6855805
Organism Unknown
Organism Diet
Organism Clade
Organism Region
Notes

Sequence
atgttcaccgtgtttctgttggttgtcttgacaaccactg
tcgtttccttcccttcagatagtgcatctggtggcaggga
tgacgaggccaaagacgaaaggtctgacatgtacgaattg
aaacggaatggacactgttgccatcctgcctgtggtggca
aatacgttaaatgtggacgc
tgatgctccaggaccctctc
gaaccacg
Sequence translation MFTVFLLVVLTTTVVSFPSDSASGGRDDEAKDERSDMYEL
KRNGHCCHPACGGKYVKCGR

References
Olivera,B.M., Layer,R.T., McIntosh,J.M., Nielsen,J.S. and Jones,R.M. (2005) Alpha.-conotoxin peptides Patent: US 6855805 15-FEB-2005

Internal links
Proteins Encoded Sequence 49 from patent US 6855805

External links
Ncbi
GenBank AR637252

Tools