Conus imperialis contoxin ImIIA precursor (imiia) mRNA, complete cds (N00938) Nucleic Acid Card

General Information
Name Conus imperialis contoxin ImIIA precursor (imiia) mRNA, complete cds
Organism Conus imperialis
Organism Diet vermivorous
Organism Clade XVII
Organism Region Indo-Pacific
Notes

Sequence
atgggcatgcggatgatgttcaccgtgtttctgttggttg
tcttggcaactgctgttcttccagtcactttagatcgtgc
atctgatggaaggaatgcagcagccaacgccaaaacgcct
cgcctgatcgcgccattcatcagggattattgctgtcata
gaggtccctgtatggtatggtgtggt
tga
Sequence translation MGMRMMFTVFLLVVLATAVLPVTLDRASDGRNAAANAKTP
RLIAPFIRDYCCHRGPCMVWCG

References
Zhao,D. and Huang,P. (0) Conus imperialis conotoxin ImIIA precursor mRNA

Internal links
Proteins Encoded ImIIA precursor

External links
Ncbi
GenBank AF200595

Tools