Conus betulinus BeTX toxin precursor (BeTX) mRNA, complete cds (N00939) Nucleic Acid Card

General Information
Name Conus betulinus BeTX toxin precursor (BeTX) mRNA, complete cds
Organism Conus betulinus
Organism Diet vermivorous
Organism Clade X
Organism Region Indo-Pacific
Notes

Sequence
ctgaaggcgcacttgaacaggacacgaggaccctgaacag
gaagagtgagatcagagaggcagagaagtgacggagatca
acagtga
atgatgtttcgtgtgacgtcagtcggctgtctc
ctgctggtcatcgtttttctgaacttggttgtgcctacca
gtgcctgccgcgctgaaggaacgtactgtgaaaatgattc
ccaatgctgtctaaatgaatgctgttgggggggttgcgga
catccgtgtcgccatcctggaaagaggtcgaaactccaag
aattctttcgacaacgt
tgatatgttgctcagaggtctgc
tgcttctcgtcgtaaatggcagataactcaagcctgacgt
ctctgcagttctttctccccgtcttcttcttccttcgccc
ctctcacctcctctccctcctcctccccgcaccatgctaa
taaatttgatgctgcagaatcct
Sequence translation MMFRVTSVGCLLLVIVFLNLVVPTSACRAEGTYCENDSQC
CLNECCWGGCGHPCRHPGKRSKLQEFFRQR

References
Fan,C.X., Chen,X.K., Zhang,C., Wang,L.X., Duan,K.L., He,L.L., Cao,Y., Liu,S.Y., Zhong,M.N., Ulens,C., Tytgat,J., Chen,J.S., Chi,C.W. and Zhou,Z. (2003) A Novel Conotoxin from Conus betulinus, kappa -BtX, Unique in Cysteine Pattern and in Function as a Specific BK Channel Modulator J. Biol. Chem. 278:12624-12633

Internal links
Proteins Encoded BtX precursor

External links
Ncbi
GenBank AF208661

Tools