Conus ventricosus clone VnMLCL-022 conotoxin scaffold IX precursor, mRNA, complete cds (N00094) Nucleic Acid Card

General Information
Name Conus ventricosus clone VnMLCL-022 conotoxin scaffold IX precursor, mRNA, complete cds
Organism Conus ventricosus
Organism Diet molluscivorous
Organism Clade
Organism Region Eastern Atlantic and Mediterranean
Notes

Sequence
cgtgtttaccaacagctacgcctgccaaccgatcctttct
ctgcgctacgtggcactttgcagtgaatctgactacaagc
aca
atgctgtgtcttccggtcttcatcatccttcttctgt
tggcttcacctgcagctccaaaccctttggaaaagagaat
ccaaagcgatttgattcgcgcagcccttgaagatgccgat
atgaaaaccggtgaacgggagatcctcaacataatagatt
caattagtgacgtagccaagcaaatttgctgccagattac
tgtggactgctgtgttcttgacgaggaa
taatcaataaag
gatggctgactttggaaacgacacctccaaactgtacccg
gatatgagatgtaaaaacaggctgtttcttttgcacatgc
tcgtgtgggttgaaacagtcgtcaaatatacgttgccatt
tgcgttgtcatgttctccgttttattggcagaactgcata
ccaaattagactaaatgtcttggagattgaacttattttc
tacagagtataggcagngacgaattggngatagttcaatt
aattctgattatctaaaactgcttccacatctttttatgt
gtgctttttgngacat
Sequence translation MLCLPVFIILLLLASPAAPNPLEKRIQSDLIRAALEDADM
KTGEREILNIIDSISDVAKQICCQITVDCCVLDEE

References
Conticello,S.G., Gilad,Y., Avidan,N., Ben-Asher,E., Levy,Z. and Fainzilber,M. (2001) Mechanisms for evolving hypervariability: the case of conopeptides Mol. Biol. Evol. 18:120-131

Internal links
Proteins Encoded Vn5.6 precursor

External links
Ncbi
GenBank AF214994

Tools