Conus striatus clone 02C06 T-superfamily derived conotoxin precursor, mRNA, complete cds (N00941) Nucleic Acid Card

General Information
Name Conus striatus clone 02C06 T-superfamily derived conotoxin precursor, mRNA, complete cds
Organism Conus striatus (Striated cone)
Organism Diet piscivorous
Organism Clade I
Organism Region Indo-Pacific
Notes

Sequence
gagtgtttaccaacagctacgcctgccaaccaattctttc
tctgcgctacgtgacactttgcagtgtgagaacaagaatc
tgactacaagcaca
atgctgtgtcttccggtcttcatcat
gcttcttctgttggcttcacctgcagctccaaaccctttg
gaaacgagaacccaaagtgacttgattcgcgcagcccttg
aagatgccgatgcgaaacccgatgaacggtttttgggcgg
tatattcggcggcatatctttactcagcgcccttatcaac
gctttgagctct
taaggattgatgctgactttggaaacga
cacctccaaactgtacccggatatgagatgtaaacaaaac
aggctgtttcttttcgaaatgctcgtgtgggttgaaacag
tcgtcaaatatacgttgccatttgcattgtcatgctctcc
gttttatttgcagaactgtataccaaaatagactaaatgt
cttgaaaattgaactcattttctacatagtatagtccgtg
accaactgataatagttcaattaattctgaatatctaaac
ctgcttcaacatctttttatgcgggctttttttgtgacat
tttccgtttcgctaggtcgtctgcaagtacaacgatattg
tcctccttttcttcattcatggcagagaaaactcaccatt
gccaatgtaaccattttaattacctagctttagagtgact
tctcttcagtgntgaatgttcaacctgcatacaaaagagt
ggtcagatcgactataaaacgcttgcatggcaatgccaaa
a
Sequence translation MLCLPVFIMLLLLASPAAPNPLETRTQSDLIRAALEDADA
KPDERFLGGIFGGISLLSALINALSS

References
Pi,C., Liu,Y., Peng,C., Jiang,X., Liu,J., Xu,B., Yu,X., Yu,Y., Jiang,X., Wang,L., Dong,M., Chen,S. and Xu,A.L. (2006) Analysis of expressed sequence tags from the venom ducts of Conus striatus: focusing on the expression profile of conotoxins Biochimie 88:131-140

Internal links
Proteins Encoded Conotoxin precursor

External links
Ncbi
GenBank DQ117943

Tools